PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G158500.2
Common NameB456_011G158500, LOC105778014
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 298aa    MW: 32686 Da    PI: 6.6255
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G158500.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1092.4e-343993155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYRl
  Gorai.011G158500.2 39 KPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKYRL 93
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-333694IPR009057Homeodomain-like
PROSITE profilePS5129413.0953696IPR017930Myb domain
SuperFamilySSF466891.74E-173896IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-243994IPR006447Myb domain, plants
PfamPF002498.9E-94192IPR001005SANT/Myb domain
PfamPF143793.1E-25132178IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0010628Biological Processpositive regulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MYSAIRSLPL DGRVGDYQGS LDGTNLPGDA CLVLTTDPKP RLRWTAELHE RFVDAVTQLG  60
GPDKATPKTI MRTMGVKGLT LYHLKSHLQK YRLGKQSCKE STDNSKDESQ DTGSSTTSSS  120
RMIAQDLNDG YQVTEALRAQ MEVQRRLHEQ LEVQHRLQLR IEAQSKYLQS MLEKACKALT  180
DQDEAASTGL EAAREELSEL AIKVSNDCQG MIPPHDNIKL PSLSELAVVL ENNRTSNMPG  240
RIGHCSVESC LTSSGSPVGS QAGIMKKRPR PVFGNGEPLP LDGNIRQEIE WGMPNIS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1266270KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012457014.10.0PREDICTED: myb family transcription factor APL isoform X2
SwissprotQ9SAK57e-66APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0D2UUL10.0A0A0D2UUL1_G
STRINGVIT_05s0029g00060.t011e-153(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-126G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]